PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0088s0320.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TALE
Protein Properties Length: 320aa    MW: 36225.3 Da    PI: 4.7639
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0088s0320.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox277.6e-092532852355
                             SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRake 55 
                             +yp++ee+++L+++ gL+++q+ +WF N+R ++
  SapurV1A.0088s0320.2.p 253 PYPTEEEKAKLSENSGLDQKQINNWFINQRKRH 285
                             8*****************************885 PP

2ELK249.1e-09206226222
                     ELK   2 LKhqLlrKYsgyLgsLkqEFs 22 
                             LK  Ll KYsg+L++L++EF+
  SapurV1A.0088s0320.2.p 206 LKGVLLSKYSGHLSNLRKEFL 226
                             89999***************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.9E-1863107IPR005540KNOX1
PfamPF037905.9E-1965103IPR005540KNOX1
SMARTSM012562.0E-25110161IPR005541KNOX2
PfamPF037911.4E-24113160IPR005541KNOX2
SMARTSM011881.8E-5205226IPR005539ELK domain
PROSITE profilePS512139.498205225IPR005539ELK domain
PfamPF037897.0E-8206226IPR005539ELK domain
PROSITE profilePS5007112.147225288IPR001356Homeobox domain
SMARTSM003894.1E-12227292IPR001356Homeobox domain
SuperFamilySSF466892.52E-17227295IPR009057Homeodomain-like
CDDcd000862.50E-13229289No hitNo description
Gene3DG3DSA:1.10.10.604.5E-26230291IPR009057Homeodomain-like
PfamPF059207.8E-16245284IPR008422Homeobox KN domain
PROSITE patternPS000270263286IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MEGFYRFNPT ITCSPNDIDR LENLPVVKFT DATTSTDEFH SQVGNLLQAG HEYTQVTGSD  60
MHDVIKTQIA SHPRYPDLVS AYVECRKVGA PPETVSLLDD IGRWSYQIDT YYEIGADPEL  120
DEFMESYCEV LHRYKEELSK PFDEATTFLS GIESQLRSLC KGTLTKIFDD GSDEPAGTSE  180
EELSCGEVEA SEIPDSLGTH PSDQNLKGVL LSKYSGHLSN LRKEFLKQRK KGKLPKDART  240
MLLDWWNHHS RWPYPTEEEK AKLSENSGLD QKQINNWFIN QRKRHWKPSK DMRFALMESV  300
RGDSAGPPCY GIDGDDIGT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2090452e-32AC209045.1 Populus trichocarpa clone POP061-B03, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011023780.10.0PREDICTED: homeobox protein knotted-1-like 1 isoform X4
SwissprotQ9FP292e-94KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLB9I6Z30.0B9I6Z3_POPTR; Uncharacterized protein
STRINGPOPTR_0013s01000.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.17e-81KNOTTED1-like homeobox gene 6